PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01192.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 322aa    MW: 37087.7 Da    PI: 4.749
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01192.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.3e-182168148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+eEd +l ++++ +G g+W++ +r+ g+ Rt+k+c++rw++yl
  Rsa1.0_01192.1_g00001.1 21 RGPWTAEEDFKLMNYIATHGEGRWNSLSRCAGLQRTGKSCRLRWLNYL 68
                             89********************************************97 PP

2Myb_DNA-binding50.54.8e-1674117146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Rsa1.0_01192.1_g00001.1  74 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3631668IPR017930Myb domain
SuperFamilySSF466892.25E-3118115IPR009057Homeodomain-like
SMARTSM007175.9E-142070IPR001005SANT/Myb domain
PfamPF002496.1E-162168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-232275IPR009057Homeodomain-like
CDDcd001676.42E-112368No hitNo description
PROSITE profilePS5129422.91769123IPR017930Myb domain
SMARTSM007172.9E-1473121IPR001005SANT/Myb domain
PfamPF002498.0E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2276122IPR009057Homeodomain-like
CDDcd001679.36E-794117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MDEKGRNLNN NNMEDEMDLK RGPWTAEEDF KLMNYIATHG EGRWNSLSRC AGLQRTGKSC  60
RLRWLNYLRP DVRRGNITLE EQLLILELHS RWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ  120
KHAKQLKCDV NSQQFKDTMK YLWMPRLVER IHSASAAATV ATTTNTTTTT GSAATSSSNT  180
TSNNQFMTYD YNNNSLGQQF GVVNNEYSTP ENSNVAVSPM SDLTEYYSAP NPYPEYYSGQ  240
VGNSYHPDQD LVVPQMLPDN YYDYSGLLDE DLPGMQEQSN LNWFEDFNGV TSSSDSLWNI  300
GESNEDLWFL QAQQQFNNNG NF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-251811524120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584557.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-178MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D3CMB30.0A0A0D3CMB3_BRAOL; Uncharacterized protein (Fragment)
STRINGBra029582.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.11e-155myb domain protein 108